Structure of PDB 5lmn Chain D

Receptor sequence

>5lmnD (length=208) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRP
SDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRL
DNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEK
SRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ
LVIEFYSR

3D structure

PDB

5lmn Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.

Chain

Resolution

3.55 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	G2 I5 P7 V8 C9 R10 R13 R14 K22 E24 R25 K30 R35 R36 P40 G41 Q42 H43 K46 S52 Y54 A55 R59 Q62 R65 S71 E72 R73 Q74 R76 N77 S113 R115 Q116 R118 Q119 R122 H123 H125 R131 R132 D134 L135 S137 Y138 K151 L155 E205 R209	G1 I4 P6 V7 C8 R9 R12 R13 K21 E23 R24 K29 R34 R35 P39 G40 Q41 H42 K45 S51 Y53 A54 R58 Q61 R64 S70 E71 R72 Q73 R75 N76 S112 R114 Q115 R117 Q118 R121 H122 H124 R130 R131 D133 L134 S136 Y137 K150 L154 E204 R208
BS02	ZN	D	C9 C26 C31	C8 C25 C30

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5lmn, PDBe:5lmn, PDBj:5lmn
PDBsum	5lmn
PubMed	27662086
UniProt	P80373\|RS4_THET8 Small ribosomal subunit protein uS4 (Gene Name=rpsD)

[Back to BioLiP]