Structure of PDB 5l8g Chain D |
>5l8gD (length=91) Species: 1085 (Rhodospirillum rubrum) [Search protein sequence] |
STHEPLEVLKEETVNRHRAIVSVMEELEAVDWYDQRVDASTDPELTAILA HNRDEEKEAAAMTLEWLRRNDAKWAEHLRTYLFTEGPITAA |
|
PDB | 5l8g Structural characterization of encapsulated ferritin provides insight into iron storage in bacterial nanocompartments. |
Chain | D |
Resolution | 2.974 Å |
3D structure |
|
|
Enzyme Commision number |
1.16.3.1: ferroxidase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
D |
Y39 E62 |
Y33 E56 |
|
|
|
|