Structure of PDB 5l1z Chain D

Receptor sequence
>5l1zD (length=49) Species: 11678 (Human immunodeficiency virus type 1 BH10) [Search protein sequence]
MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGR
3D structure
PDB5l1z Insights into HIV-1 proviral transcription from integrative structure and dynamics of the Tat:AFF4:P-TEFb:TAR complex.
ChainD
Resolution5.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D N24 C25 Y26 N24 C25 Y26 PDBbind-CN: Kd=0.20nM
BS02 ZN D C22 H33 C34 C22 H33 C34
Gene Ontology
Molecular Function
GO:0001070 RNA-binding transcription regulator activity
Biological Process
GO:0050434 positive regulation of viral transcription
Cellular Component
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5l1z, PDBe:5l1z, PDBj:5l1z
PDBsum5l1z
PubMed27731797
UniProtP69697|TAT_HV1B1 Protein Tat (Gene Name=tat)

[Back to BioLiP]