Structure of PDB 5kq4 Chain D

Receptor sequence
>5kq4D (length=126) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence]
MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSI
EGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTEN
QHVVGLWMFDPNDMSRIFNIVKESLL
3D structure
PDB5kq4 Structural basis of mRNA-cap recognition by Dcp1-Dcp2.
ChainD
Resolution2.56 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide D Y36 F38 V40 W45 N86 V90 Y93 I95 R97 W107 Y36 F38 V40 W45 N86 V90 Y93 I95 R97 W107
BS02 peptide D N76 L77 H102 V104 N76 L77 H102 V104
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008047 enzyme activator activity
GO:0170008 mRNA phosphatase activator activity
Biological Process
GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000290 deadenylation-dependent decapping of nuclear-transcribed mRNA
GO:0000956 nuclear-transcribed mRNA catabolic process
GO:0006397 mRNA processing
GO:0043085 positive regulation of catalytic activity
GO:0110156 mRNA methylguanosine-cap decapping
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0010494 cytoplasmic stress granule
GO:0098745 RNA decapping complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5kq4, PDBe:5kq4, PDBj:5kq4
PDBsum5kq4
PubMed27694842
UniProtQ9P805|DCP1_SCHPO mRNA-decapping enzyme subunit 1 (Gene Name=dcp1)

[Back to BioLiP]