Structure of PDB 5jfy Chain D |
>5jfyD (length=117) Species: 3716 (Brassica oleracea var. capitata) [Search protein sequence] |
GHQQAVLDSDHKFLTQAVEEAYKGVDCGDGGPFGAVIVHKNEVVASCHNM VLKYTDPTAHAEVTAIREACKKLNQIELSECEIYASCEPCPMCFGAIHLS RLKRLVYGAEAAIAIGF |
|
PDB | 5jfy To be published |
Chain | D |
Resolution | 2.101 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
E82 E108 C110 |
Catalytic site (residue number reindexed from 1) |
E62 E88 C90 |
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
D |
H80 C110 C113 |
H60 C90 C93 |
|
|
|
|