Structure of PDB 5j63 Chain D

Receptor sequence
>5j63D (length=301) Species: 656414 (Escherichia coli H736) [Search protein sequence]
MKTVVFAYHDMGCLGIEALLAAGYEISAIFTHTDNPGEKAFYGSVARLAA
ERGIPVYAPDNVNHPLWVERIAQLSPDVIFSFYYRHLIYDEILQLAPAGA
FNLHGSLLPKYRGRAPLNWVLVNGETETGVTLHRMVKRADAGAIVAQLRI
AIAPDDIAITLHHKLCHAARQLLEQTLPAIKHGNILEIAQRENEATCFGR
RTPDDSFLEWHKPASVLHNMVRAVADPWPGAFSYVGNQKFTVWSSRVHPQ
PGSVISVAPLLIACGDGALEIVTGQAGDGITMQGSQLAQTLGLVQGSRLN
S
3D structure
PDB5j63 Structure of the Escherichia coli ArnA N-formyltransferase domain in complex with N(5) -formyltetrahydrofolate and UDP-Ara4N.
ChainD
Resolution2.5 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 G3N D E38 Y83 Y84 R85 H104 R114 A115 P116 N118 R201 T202 P203 E38 Y83 Y84 R85 H104 R114 A115 P116 N118 R201 T202 P203
BS02 FNX D Y84 H86 I88 N102 M135 V136 A139 D140 Y84 H86 I88 N102 M135 V136 A139 D140
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 14:36:01 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5j63', asym_id = 'D', title = 'Structure of the Escherichia coli ArnA N-formylt... with N(5) -formyltetrahydrofolate and UDP-Ara4N.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5j63', asym_id='D', title='Structure of the Escherichia coli ArnA N-formylt... with N(5) -formyltetrahydrofolate and UDP-Ara4N.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003824,0009058', uniprot = '', pdbid = '5j63', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003824,0009058', uniprot='', pdbid='5j63', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>