Structure of PDB 5iro Chain D |
>5iroD (length=102) Species: 28280 (Human adenovirus E4) [Search protein sequence] |
ADPCLTFNPDKCQLSFQPDGNRCAVLIKCGWECQSVAIQYKNKTRNNTLA STWQPGDPEWYTVSVPGADGFLRTVNNTFIFEHMCNTAMFMSRQYHMWPP RK |
|
PDB | 5iro Structure of the Adenovirus Type 4 (Species E) E3-19K/HLA-A2 Complex Reveals Species-Specific Features in MHC Class I Recognition. |
Chain | D |
Resolution | 2.64 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
D |
D8 P9 |
D2 P3 |
|
|
|
|