Structure of PDB 5imt Chain D |
>5imtD (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] |
LQCYNCPNPTADCKTAVNCSSAFDACLITKAGLQVYNKCWKFEHCNFNDV TTRLRENELTYYCCKKDLCNFNEQLEN |
|
PDB | 5imt Structural Basis for Receptor Recognition by the Human CD59-Responsive Cholesterol-Dependent Cytolysins. |
Chain | D |
Resolution | 2.7001 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
D |
H44 R53 |
H44 R53 |
|
|
|