Structure of PDB 5hvk Chain D

Receptor sequence
>5hvkD (length=164) Species: 9606 (Homo sapiens) [Search protein sequence]
ASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEE
GKEILVGDVGQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVF
IFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAE
KLGGSAVISLEGKP
3D structure
PDB5hvk Structural Basis for Noncanonical Substrate Recognition of Cofilin/ADF Proteins by LIM Kinases.
ChainD
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ANP D A2 S3 A1 S2
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005515 protein binding
GO:0051015 actin filament binding
Biological Process
GO:0000281 mitotic cytokinesis
GO:0007010 cytoskeleton organization
GO:0007266 Rho protein signal transduction
GO:0009615 response to virus
GO:0022604 regulation of cell morphogenesis
GO:0030036 actin cytoskeleton organization
GO:0030042 actin filament depolymerization
GO:0030043 actin filament fragmentation
GO:0040019 positive regulation of embryonic development
GO:0043066 negative regulation of apoptotic process
GO:0044794 positive regulation by host of viral process
GO:0051014 actin filament severing
GO:0051293 establishment of spindle localization
GO:0061001 regulation of dendritic spine morphogenesis
Cellular Component
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0005925 focal adhesion
GO:0015629 actin cytoskeleton
GO:0016020 membrane
GO:0016363 nuclear matrix
GO:0030027 lamellipodium
GO:0030424 axon
GO:0030426 growth cone
GO:0031258 lamellipodium membrane
GO:0031982 vesicle
GO:0032587 ruffle membrane
GO:0042995 cell projection
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5hvk, PDBe:5hvk, PDBj:5hvk
PDBsum5hvk
PubMed27153537
UniProtP23528|COF1_HUMAN Cofilin-1 (Gene Name=CFL1)

[Back to BioLiP]