Structure of PDB 5gip Chain D

Receptor sequence
>5gipD (length=122) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence]
ASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVII
AEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILE
PGEAKDLVDEIIKRVNEIKGKT
3D structure
PDB5gip Box C/D guide RNAs recognize a maximum of 10 nt of substrates
ChainD
Resolution3.129 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D K37 G38 T39 N40 E41 V60 Q61 I65 K86 L95 V97 A98 T99 A100 K31 G32 T33 N34 E35 V54 Q55 I59 K80 L89 V91 A92 T93 A94
BS02 rna D E41 K44 R48 E35 K38 R42
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5gip, PDBe:5gip, PDBj:5gip
PDBsum5gip
PubMed27625427
UniProtP55858|RL7A_SACS2 Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]