Structure of PDB 5g4u Chain D

Receptor sequence
>5g4uD (length=117) Species: 2234 (Archaeoglobus fulgidus) [Search protein sequence]
SYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIA
EDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINE
GELRKELGSLVEKIKGL
3D structure
PDB5g4u A Quasi-Cyclic RNA Nano-Scale Molecular Object Constructed Using Kink Turns.
ChainD
Resolution2.65 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D E34 E89 E34 E89
BS02 rna D K30 G31 T32 N33 E34 D54 I58 K79 I88 E89 V90 C92 A93 K30 G31 T32 N33 E34 D54 I58 K79 I88 E89 V90 C92 A93
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5g4u, PDBe:5g4u, PDBj:5g4u
PDBsum5g4u
PubMed27506301
UniProtO29494|RL7A_ARCFU Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]