Structure of PDB 5fd6 Chain D

Receptor sequence
>5fd6D (length=133) Species: 387 (Rhizobium leguminosarum bv. viciae) [Search protein sequence]
KTLEELATERGMRMTEQRRVIARILEDSEDHPDVEELYRRSVKVDAKISI
STVYRTVKLFEDAGIIARHDFRDGRSRYETVPEEHHDHLIDLKTGTVIEF
RSPEIEALQERIAREHGFRLVDHRLELYGVPLK
3D structure
PDB5fd6 structure of a zinc-bound manganese uptake regulator, mur
ChainD
Resolution2.48 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN D H36 E84 H91 H93 H31 E79 H86 H88
BS02 ZN D H90 D92 E111 H128 H85 D87 E106 H123
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:1900376 regulation of secondary metabolite biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5fd6, PDBe:5fd6, PDBj:5fd6
PDBsum5fd6
PubMed
UniProtO07315|FUR_RHILV Ferric uptake regulation protein (Gene Name=fur)

[Back to BioLiP]