Structure of PDB 5eiu Chain D

Receptor sequence

>5eiuD (length=132) Species: 9544,262724

DHCARHGEKLLLFCQEDSKVICWLCERSQEHRGHHTFLMEEVAQEYHVKL
QTALEMLRQKQQEAETERNQVAKRVPKAPPEEKEALIARGKALGEQTQYM
RELISELEHRLQGSMMDLLQGVDGIIKRIENM

3D structure

• PDB: 5eiu Mechanism of B-box 2 domain-mediated higher-order assembly of the retroviral restriction factor TRIM5 alpha.
• Chain: D
• Resolution: 1.908 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K221
• Catalytic site (residue number reindexed from 1): K127
• Enzyme Commision number: 2.3.2.27: RING-type E3 ubiquitin transferase.
  6.1.1.11: serine--tRNA ligase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	D	C108 D111 H125 H128	C14 D17 H31 H34
BS02	ZN	D	C97 H100 C116 C119	C3 H6 C22 C25

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0008270 zinc ion binding

External links

• PDB: RCSB:5eiu, PDBe:5eiu, PDBj:5eiu
• PDBsum: 5eiu
• PubMed: 27253059
• UniProt: P34945|SYS_THET2 Serine--tRNA ligase (Gene Name=serS);
  Q0PF16|TRIM5_MACMU Tripartite motif-containing protein 5 (Gene Name=TRIM5)