Structure of PDB 5eib Chain D

Receptor sequence

>5eibD (length=430) Species: 9913 (Bos taurus)

REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYY
NEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNW
AKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLL
ISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYS
IDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLR
KLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMA
ACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKT
AVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGE
GMDEMEFTEAESNMNDLVSEYQQYQDATAD

3D structure

• PDB: 5eib Molecular basis for CPAP-tubulin interaction in controlling centriolar and ciliary length
• Chain: D
• Resolution: 2.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	D	Y108 R158 H192 Q193 E196 P263 G412 E417 E420 N424 D427	Y105 R155 H189 Q190 E193 P260 G401 E406 E409 N413 D416
BS02	GTP	D	G10 Q11 C12 A99 G100 N101 S140 G143 G144 T145 G146 E183 N206 Y224 N228	G9 Q10 C11 A96 G97 N98 S137 G140 G141 T142 G143 E180 N203 Y221 N225

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005200 structural constituent of cytoskeleton
• GO:0005525 GTP binding
• GO:0046872 metal ion binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0000226 microtubule cytoskeleton organization
• GO:0000278 mitotic cell cycle
• GO:0007017 microtubule-based process
• GO:0007399 nervous system development
• GO:1902669 positive regulation of axon guidance

Cellular Component

• GO:0005737 cytoplasm
• GO:0005856 cytoskeleton
• GO:0005874 microtubule
• GO:0015630 microtubule cytoskeleton

External links

• PDB: RCSB:5eib, PDBe:5eib, PDBj:5eib
• PDBsum: 5eib
• PubMed: 27306797
• UniProt: Q6B856|TBB2B_BOVIN Tubulin beta-2B chain (Gene Name=TUBB2B)