Structure of PDB 5e5a Chain D

Receptor sequence
>5e5aD (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGE
ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
3D structure
PDB5e5a Human cytomegalovirus IE1 protein alters the higher-order chromatin structure by targeting the acidic patch of the nucleosome
ChainD
Resolution2.809 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D R27 T29 S52 S53 R83 S84 T85 R4 T6 S29 S30 R60 S61 T62
BS02 dna D K24 R26 K28 R30 E32 S33 I36 Y37 K1 R3 K5 R7 E9 S10 I13 Y14
BS03 MG D E102 K105 H106 E79 K82 H83
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5e5a, PDBe:5e5a, PDBj:5e5a
PDBsum5e5a
PubMed26812545
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]