Structure of PDB 5ddq Chain D

Receptor sequence
>5ddqD (length=93) Species: 9606 (Homo sapiens) [Search protein sequence]
VPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMR
GQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIA
3D structure
PDB5ddq Structural and Dynamic Basis for Low-Affinity, High-Selectivity Binding of L-Glutamine by the Glutamine Riboswitch.
ChainD
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D Y12 N14 N15 E18 K21 L43 R46 S47 L48 K49 M50 R51 Q53 F55 K79 Q84 A86 K87 T88 D89 S90 D91 Y11 N13 N14 E17 K20 L42 R45 S46 L47 K48 M49 R50 Q52 F54 K78 Q83 A85 K86 T87 D88 S89 D90
BS02 rna D R6 T88 R5 T87
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:5ddq, PDBe:5ddq, PDBj:5ddq
PDBsum5ddq
PubMed26655897
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]