Structure of PDB 5ch7 Chain D

Receptor sequence

>5ch7D (length=327) Species: 640081 (Azospira oryzae PS)

APRRQLTYVTDLNKCIGCQTCTVACKKLWTTGPGQDFMYWRNVETAPGLG
YPRNWQTKGGGYKNGELQKGKIPPMIDYGIPFEFDYAGRLFEGKPGRVRP
SPTPRSAPNWDEDQGAGEYPNNSFFYLPRMCNHCTKPACLEACPNEAIYK
REQDGIVVIHQDKCKGAQACVQSCPYAKPYFNPLTNKANKCIGCFPRIEQ
GVAPACVAQCVGRAMHVGFVDDVNSSVYKLIKQYKVALPLHPEFGTEPNV
FYVPPVLGPRIEMANGEPSTDPKIPLAQLEGLFGKQVRDVLAILQSEREK
KMKGLASDLMDVLIGRRSTDMMISPLT

3D structure

• PDB: 5ch7 Perchlorate Reductase Is Distinguished by Active Site Aromatic Gate Residues.
• Chain: D
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	F3S	D	C149 P150 I154 C170 G172 A173 Q174 A175 C176 A194	C143 P144 I148 C164 G166 A167 Q168 A169 C170 A188
BS02	SF4	D	C137 N138 H139 C140 C145 C180 Y182 K196	C131 N132 H133 C134 C139 C174 Y176 K190
BS03	SF4	D	C21 I22 G23 C24 C27 R47 V49 P134 C216 V217 G218	C15 I16 G17 C18 C21 R41 V43 P128 C210 V211 G212
BS04	SF4	D	C31 W35 R47 C197 G199 C200 C212	C25 W29 R41 C191 G193 C194 C206

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051538 3 iron, 4 sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009061 anaerobic respiration

Cellular Component

• GO:0016020 membrane
• GO:0042597 periplasmic space

External links

• PDB: RCSB:5ch7, PDBe:5ch7, PDBj:5ch7
• PDBsum: 5ch7
• PubMed: 26940877
• UniProt: G8QM54