Structure of PDB 5aox Chain D

Receptor sequence
>5aoxD (length=73) Species: 9606 (Homo sapiens) [Search protein sequence]
PQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVSLVY
KTDQAQDVKKIEKFHSQLMRLMV
3D structure
PDB5aox Retrotransposition and Crystal Structure of an Alu Rnp in the Ribosome-Stalling Conformation.
ChainD
Resolution2.04 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D P2 R26 K30 R32 K41 D45 L46 S48 P1 R25 K29 R31 K40 D44 L45 S47
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005047 signal recognition particle binding
GO:0005515 protein binding
GO:0008312 7S RNA binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
GO:0045900 negative regulation of translational elongation
Cellular Component
GO:0005737 cytoplasm
GO:0005785 signal recognition particle receptor complex
GO:0005786 signal recognition particle, endoplasmic reticulum targeting
GO:0005829 cytosol
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5aox, PDBe:5aox, PDBj:5aox
PDBsum5aox
PubMed26585389
UniProtP49458|SRP09_HUMAN Signal recognition particle 9 kDa protein (Gene Name=SRP9)

[Back to BioLiP]