Structure of PDB 4za2 Chain D

Receptor sequence
>4za2D (length=247) Species: 555 (Pectobacterium carotovorum subsp. carotovorum) [Search protein sequence]
MILNSFDLQGKVALITGCDTGLGQGMAIGLAQAGCDIVGVNIVEPKDTIE
KVTALGRRFLSLTADMSNVSGHAELVEKAVAEFGHVDILVNNAGIIRRED
AIEFSEKNWDDVMNLNIKSVFFMSQTVARQFIKQGKGGKIINIASMLSFQ
GGIRVPSYTASKSAVMGVTRLMANEWAKHGINVNAIAPGYMATNNTQERS
KEILDRIPAGRWGLPQDLMGPSVFLASSASDYINGYTIAVDGGWLAR
3D structure
PDB4za2 Structural determinants in bacterial 2-keto-3-deoxy-D-gluconate dehydrogenase KduD for dual-coenzyme specificity
ChainD
Resolution1.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAD D G17 D19 L22 I42 D65 M66 N92 A93 G94 L115 I143 S145 Y158 K162 G189 M191 T193 N195 G17 D19 L22 I42 D65 M66 N92 A93 G94 L115 I143 S145 Y158 K162 G189 M191 T193 N195
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Nov 25 13:35:06 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4za2', asym_id = 'D', title = 'Structural determinants in bacterial 2-keto-3-de... dehydrogenase KduD for dual-coenzyme specificity'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4za2', asym_id='D', title='Structural determinants in bacterial 2-keto-3-de... dehydrogenase KduD for dual-coenzyme specificity')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0008678,0016491,0051287', uniprot = '', pdbid = '4za2', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0008678,0016491,0051287', uniprot='', pdbid='4za2', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>