Structure of PDB 4z89 Chain D

Receptor sequence
>4z89D (length=65) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
FRYFVAMFDYDPSTMSPNPDGCDEELPFQEGDTIKVFGDKDADGFYWGEL
RGRRGYVPHNMVSEV
3D structure
PDB4z89 A high affinity RIM-binding protein/Aplip1 interaction prevents the formation of ectopic axonal active zones.
ChainD
Resolution2.64 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide D F1353 W1363 R1370 F37 W47 R54
BS02 peptide D M1323 F1324 P1333 N1334 E1346 D1359 G1360 F1361 Y1372 P1374 H1375 N1376 M1377 M7 F8 P17 N18 E30 D43 G44 F45 Y56 P58 H59 N60 M61
External links