Structure of PDB 4ytp Chain D

Receptor sequence

>4ytpD (length=102) Species: 9823 (Sus scrofa)

SSKAASLHWTGERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGI
GQVVTDYVRGDALQKVAKAGLLALSAFTFAGLCYFNYHDVGICKAVAMLW
KL

3D structure

• PDB: 4ytp Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
• Chain: D
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	D	L53 L54 H79 G83	L19 L20 H45 G49
BS02	E23	D	D90 Y91	D56 Y57

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0048039 ubiquinone binding

Biological Process

• GO:0006099 tricarboxylic acid cycle
• GO:0006121 mitochondrial electron transport, succinate to ubiquinone

Cellular Component

• GO:0005739 mitochondrion
• GO:0005740 mitochondrial envelope
• GO:0005743 mitochondrial inner membrane
• GO:0016020 membrane
• GO:0045273 respiratory chain complex II (succinate dehydrogenase)

External links

• PDB: RCSB:4ytp, PDBe:4ytp, PDBj:4ytp
• PDBsum: 4ytp
• PubMed: 26198225
• UniProt: A5GZW8|DHSD_PIG Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (Gene Name=SDHD)