Structure of PDB 4xwy Chain D

Receptor sequence

>4xwyD (length=257) Species: 9606 (Homo sapiens)

GLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAE
LGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGS
LGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVV
NISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDT
DMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSG
AHVDFYD

3D structure

• PDB: 4xwy Reduction of Neuropathic and Inflammatory Pain through Inhibition of the Tetrahydrobiopterin Pathway.
• Chain: D
• Resolution: 2.35 Å

Enzymatic activity

• Enzyme Commision number: 1.1.1.153: sepiapterin reductase (L-erythro-7,8-dihydrobiopterin forming).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NDP	D	G11 S13 R14 G15 A38 R39 N40 D66 L67 N97 L123 I152 S154 Y167 K171 P195 P197 L198 T200 M202	G11 S13 R14 G15 A38 R39 N40 D66 L67 N97 L123 I152 S154 Y167 K171 P195 P197 L198 T200 M202
BS02	43O	D	S154 L155 C156 W164 Y167 A194 G196 P197 D254	S154 L155 C156 W164 Y167 A194 G196 P197 D254	MOAD: ic50=54nM BindingDB: IC50=12nM

Gene Ontology

Molecular Function

• GO:0004033 aldo-keto reductase (NADPH) activity
• GO:0004757 sepiapterin reductase (NADP+) activity
• GO:0016491 oxidoreductase activity
• GO:0050661 NADP binding

Biological Process

• GO:0006729 tetrahydrobiopterin biosynthetic process
• GO:0006809 nitric oxide biosynthetic process

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005829 cytosol
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:4xwy, PDBe:4xwy, PDBj:4xwy
• PDBsum: 4xwy
• PubMed: 26087165
• UniProt: P35270|SPRE_HUMAN Sepiapterin reductase (Gene Name=SPR)