Structure of PDB 4xid Chain D

Receptor sequence
>4xidD (length=56) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRM
KWKKEN
3D structure
PDB4xid Entropic Enhancement of Protein-DNA Affinity by Oxygen-to-Sulfur Substitution in DNA Phosphate.
ChainD
Resolution2.701 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D R5 T7 Y25 R28 R31 K46 Q50 R53 M54 R1 T3 Y21 R24 R27 K42 Q46 R49 M50 PDBbind-CN: Kd=11nM
BS02 dna D R5 Q6 Y8 I47 N51 K55 R1 Q2 Y4 I43 N47 K51 PDBbind-CN: Kd=11nM
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4xid, PDBe:4xid, PDBj:4xid
PDBsum4xid
PubMed26331260
UniProtP02833|ANTP_DROME Homeotic protein antennapedia (Gene Name=Antp)

[Back to BioLiP]