Structure of PDB 4x1k Chain D

Receptor sequence

>4x1kD (length=430) Species: 9940 (Ovis aries)

REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYY
NEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNW
AKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLL
ISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYS
IDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLR
KLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMA
ACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKT
AVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGE
GMDEMEFTEAESNMNDLVSEYQQYQDATAD

3D structure

• PDB: 4x1k Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
• Chain: D
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GDP	D	G10 Q11 C12 S140 G143 G144 T145 G146 E183 N206 Y224 N228	G9 Q10 C11 S137 G140 G141 T142 G143 E180 N203 Y221 N225
BS02	LOC	D	L248 D251 K254 L255 N258 M259 T314 K352	L245 D248 K251 L252 N255 M256 T311 K349
BS03	3WZ	D	Q11 Q15 V177 D179 Y210 P222 T223 Y224 G225	Q10 Q14 V174 D176 Y207 P219 T220 Y221 G222

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005200 structural constituent of cytoskeleton
• GO:0005525 GTP binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000226 microtubule cytoskeleton organization
• GO:0000278 mitotic cell cycle
• GO:0007017 microtubule-based process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005856 cytoskeleton
• GO:0005874 microtubule

External links

• PDB: RCSB:4x1k, PDBe:4x1k, PDBj:4x1k
• PDBsum: 4x1k
• PubMed: 25431858
• UniProt: D0VWY9