Structure of PDB 4w5j Chain D

Receptor sequence
>4w5jD (length=211) Species: 373153 (Streptococcus pneumoniae D39) [Search protein sequence]
MNLLIMGLPGAGKGTQAAKIVEQFHVAHISTGDMFRAAMANQTEMGVLAK
SYIDKGELVPDEVTNGIVKERLSQDDIKETGFLLDGYPRTIEQAHALDKT
LAELGIELEGIINIEVNPDSLLERLSGRIIHRVTGETFHKVFNPPVYKEE
DYYQREDDKPETVKRRLDVNIAQGEPIIAHYRAKGLVHDIEGNQDINDVF
SDIEKVLTNLK
3D structure
PDB4w5j New crystal structures of adenylate kinase from Streptococcus pneumoniae D39 in two conformations.
ChainD
Resolution1.65 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K13 R89 R128 R156 R167
Catalytic site (residue number reindexed from 1) K13 R89 R128 R155 R166
Enzyme Commision number 2.7.4.3: adenylate kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 AP5 D P9 G10 G12 K13 G14 T15 T31 G32 F35 R36 I53 E57 L58 V59 T64 G86 R89 Q93 R124 R128 T137 F138 H139 F142 R156 R167 I197 P9 G10 G12 K13 G14 T15 T31 G32 F35 R36 I53 E57 L58 V59 T64 G86 R89 Q93 R124 R128 T137 F138 H139 F142 R155 R166 I196
Gene Ontology
Molecular Function
GO:0004017 adenylate kinase activity
GO:0004550 nucleoside diphosphate kinase activity
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016776 phosphotransferase activity, phosphate group as acceptor
GO:0019205 nucleobase-containing compound kinase activity
GO:0050145 nucleoside monophosphate kinase activity
Biological Process
GO:0006139 nucleobase-containing compound metabolic process
GO:0009123 nucleoside monophosphate metabolic process
GO:0009132 nucleoside diphosphate metabolic process
GO:0009165 nucleotide biosynthetic process
GO:0016310 phosphorylation
GO:0044209 AMP salvage
GO:0046940 nucleoside monophosphate phosphorylation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4w5j, PDBe:4w5j, PDBj:4w5j
PDBsum4w5j
PubMed25372811
UniProtQ04ML5|KAD_STRP2 Adenylate kinase (Gene Name=adk)

[Back to BioLiP]