Structure of PDB 4uuv Chain D

Receptor sequence
>4uuvD (length=95) Species: 9606 (Homo sapiens) [Search protein sequence]
ALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPA
MNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPDALFSMAFPD
3D structure
PDB4uuv Structures of the Ets Domains of Transcription Factors Etv1, Etv4, Etv5 and Fev: Determinants of DNA Binding and Redox Regulation by Disulfide Bond Formation.
ChainD
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D Y392 R397 R400 Y403 K410 R415 Y416 Y53 R58 R61 Y64 K71 R76 Y77
BS02 dna D Q342 W381 K385 R387 M390 D393 R397 S398 Y402 P433 Q3 W42 K46 R48 M51 D54 R58 S59 Y63 P94
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4uuv, PDBe:4uuv, PDBj:4uuv
PDBsum4uuv
PubMed25866208
UniProtP43268|ETV4_HUMAN ETS translocation variant 4 (Gene Name=ETV4)

[Back to BioLiP]