Structure of PDB 4ub6 Chain D

Receptor sequence

>4ub6D (length=342) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]

ERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYT
HGLASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGL
WTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIY
PLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALL
CAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIA
FSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPE
FETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL

3D structure

PDB

4ub6 Native structure of photosystem II at 1.95 angstrom resolution viewed by femtosecond X-ray pulses.

Chain

Resolution

1.95 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FE2	D	H214 H268	H204 H258
BS02	BCT	D	H214 Y244 H268	H204 Y234 H258
BS03	CLA	D	M198 V201 A202	M188 V191 A192
BS04	CLA	D	F157 I178 L182	F147 I168 L172
BS05	PHO	D	A208 L209 I213 W253 F257	A198 L199 I203 W243 F247
BS06	PHO	D	A41 W48 G121 L122 F125 Q129 N142 F146 P149 P275 L279	A31 W38 G111 L112 F115 Q119 N132 F136 P139 P265 L269
BS07	CLA	D	F120 I123 M126 L127 F130	F110 I113 M116 L117 F120
BS08	CLA	D	V152 V156 F181 L182 F185 Q186 W191 T192 H197 G200 V201 V204 L205 S282 A283 V286	V142 V146 F171 L172 F175 Q176 W181 T182 H187 G190 V191 V194 L195 S272 A273 V276
BS09	CLA	D	P39 C40 L43 L91 L92 W93 T112 F113 H117	P29 C30 L33 L81 L82 W83 T102 F103 H107

Gene Ontology

	Molecular Function
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009523	photosystem II
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4ub6, PDBe:4ub6, PDBj:4ub6
PDBsum	4ub6
PubMed	25470056
UniProt	D0VWR8\|PSBD_THEVL Photosystem II D2 protein (Fragment) (Gene Name=psbD)

[Back to BioLiP]