Structure of PDB 4u01 Chain D

Receptor sequence

>4u01D (length=182) Species: 333284 (Hepatitis C virus (isolate Con1))

APITAYSQQTRGLLGCIITSLTGRDRNQVEGEVQVVSTATQSFLATCVNG
VCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCG
SSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHA
VGIFRAAVCTRGVAKAVDFVPVESMETTMRAS

3D structure

• PDB: 4u01 Discovery and structural diversity of the hepatitis C virus NS3/4A serine protease inhibitor series leading to clinical candidate IDX320.
• Chain: D
• Resolution: 2.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H57 D81 G137 S139
• Catalytic site (residue number reindexed from 1): H57 D81 G137 S139
• Enzyme Commision number: 2.7.7.48: RNA-directed RNA polymerase.
  3.4.21.98: hepacivirin.
  3.4.22.-
  3.6.1.15: nucleoside-triphosphate phosphatase.
  3.6.4.13: RNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	D	I3 T4 A5 Y6 S7 Q8 Q9 T10 R11 C16 T19 S20 E30 V33 Q34 V35 V36 S37 K62 T63 L64 A65 R109	I3 T4 A5 Y6 S7 Q8 Q9 T10 R11 C16 T19 S20 E30 V33 Q34 V35 V36 S37 K62 T63 L64 A65 R109
BS02	39W	D	Q41 F43 Y56 H57 D81 V132 K136 G137 S139 F154 R155 A157	Q41 F43 Y56 H57 D81 V132 K136 G137 S139 F154 R155 A157
BS03	ZN	D	C97 C99	C97 C99

Gene Ontology

Molecular Function

• GO:0008236 serine-type peptidase activity

Biological Process

• GO:0006508 proteolysis
• GO:0019087 transformation of host cell by virus

External links

• PDB: RCSB:4u01, PDBe:4u01, PDBj:4u01
• PDBsum: 4u01
• PubMed: 26410074
• UniProt: Q9WMX2|POLG_HCVCO Genome polyprotein