Structure of PDB 4ro2 Chain D |
>4ro2D (length=82) Species: 226900 (Bacillus cereus ATCC 14579) [Search protein sequence] |
LFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGK IFTILYIFIGIGLVFGFIHKLAVNVQLPSILS |
|
PDB | 4ro2 A structural, functional, and computational analysis suggests pore flexibility as the base for the poor selectivity of CNG channels. |
Chain | D |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
GLY |
D |
L27 F28 |
L1 F2 |
|
|
|
|