Structure of PDB 4rdu Chain D

Receptor sequence
>4rduD (length=62) Species: 9606 (Homo sapiens) [Search protein sequence]
VRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQ
NKRSKIKKIMKN
3D structure
PDB4rdu Crystal structure of a distal-less homeobox protein 5 (Dlx5) from Homo sapiens at 1.85 A resolution
ChainD
Resolution1.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D R154 Q157 R18 Q21
BS02 dna D R141 I143 Y161 Q186 R189 R5 I7 Y25 Q50 R53
BS03 dna D R138 K139 R141 T142 Y144 I183 N187 K191 R2 K3 R5 T6 Y8 I47 N51 K55
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4rdu, PDBe:4rdu, PDBj:4rdu
PDBsum4rdu
PubMed
UniProtP56178|DLX5_HUMAN Homeobox protein DLX-5 (Gene Name=DLX5)

[Back to BioLiP]