Structure of PDB 4rbo Chain D

Receptor sequence
>4rboD (length=54) Species: 9606 (Homo sapiens) [Search protein sequence]
TVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMK
SKRW
3D structure
PDB4rbo Structure-based discovery of NANOG variant with enhanced properties to promote self-renewal and reprogramming of pluripotent stem cells.
ChainD
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D Y119 Y136 Q144 R147 M148 K151 Y20 Y37 Q45 R48 M49 K52 PDBbind-CN: Kd=5.9uM
BS02 dna D F102 K137 W142 N145 F3 K38 W43 N46 PDBbind-CN: Kd=5.9uM
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4rbo, PDBe:4rbo, PDBj:4rbo
PDBsum4rbo
PubMed25825768
UniProtQ9H9S0|NANOG_HUMAN Homeobox protein NANOG (Gene Name=NANOG)

[Back to BioLiP]