Structure of PDB 4rb3 Chain D

Receptor sequence

>4rb3D (length=133) Species: 1430440 (Magnetospirillum gryphiswaldense MSR-1 v2) [Search protein sequence]

VSRIEQRLIDKGLKVTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRIS
IATVYRTVRLFEEESILERHDFGDGRARYEEAPSEHHDHLIDVNSARVIE
FTSPEIEALQREIARKHGFRLVGHRLELYGVPL

3D structure

PDB

4rb3 Mechanistic insights into metal ion activation and operator recognition by the ferric uptake regulator.

Chain

Resolution

2.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	D	T17 Q19 R20 R49 S51 T54 R57	T16 Q18 R19 R48 S50 T53 R56
BS02	dna	D	K15 V16 Y56 R57 A78	K14 V15 Y55 R56 A77
BS03	MN	D	H87 D89 E108 H125	H86 D88 E107 H124
BS04	MN	D	H33 E81 H88 H90 E101	H32 E80 H87 H89 E100

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0046872	metal ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0045892	negative regulation of DNA-templated transcription
GO:1900705	negative regulation of siderophore biosynthetic process

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol

External links