Structure of PDB 4qtr Chain D

Receptor sequence

>4qtrD (length=55) Species: 7227 (Drosophila melanogaster)

RTAFSEEQKKALDLAFYFDRYLTPEWRRYLSQRLGLNEAQIKIWFQNKRA
KIKKS

3D structure

• PDB: 4qtr Computational design of co-assembling protein-DNA nanowires.
• Chain: D
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	D	T6 I47 W48 N51	T2 I43 W44 N47

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 16:01:02 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4qtr', asym_id = 'D', title = 'Computational design of co-assembling protein-DNA nanowires.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4qtr', asym_id='D', title='Computational design of co-assembling protein-DNA nanowires.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0000981,0003677,0006355', uniprot = '', pdbid = '4qtr', asym_id = 'D'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000981,0003677,0006355', uniprot='', pdbid='4qtr', asym_id='D')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>