Structure of PDB 4qnq Chain D

Receptor sequence
>4qnqD (length=141) Species: 10116 (Rattus norvegicus) [Search protein sequence]
MSQSNRELVVDFLSYKLSQKGYSWPMAAVKQALREAGDEFELRYRRAFSD
LTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDK
EMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNN
3D structure
PDB4qnq Crystal Structure Analysis of full-length Bcl-XL in complex with the inhibitor ABT-263
ChainD
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 1XJ D E96 R100 Y101 F105 L108 W137 G138 S145 F146 F191 Y195 E39 R43 Y44 F48 L51 W80 G81 S88 F89 F134 Y138
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0019901 protein kinase binding
GO:0030276 clathrin binding
GO:0042802 identical protein binding
GO:0043027 cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0044877 protein-containing complex binding
GO:0051020 GTPase binding
GO:0051400 BH domain binding
GO:0051434 BH3 domain binding
GO:0097371 MDM2/MDM4 family protein binding
Biological Process
GO:0001541 ovarian follicle development
GO:0001666 response to hypoxia
GO:0001701 in utero embryonic development
GO:0001836 release of cytochrome c from mitochondria
GO:0002931 response to ischemia
GO:0006897 endocytosis
GO:0006915 apoptotic process
GO:0006979 response to oxidative stress
GO:0007005 mitochondrion organization
GO:0007281 germ cell development
GO:0007283 spermatogenesis
GO:0008406 gonad development
GO:0008584 male gonad development
GO:0008630 intrinsic apoptotic signaling pathway in response to DNA damage
GO:0009314 response to radiation
GO:0009410 response to xenobiotic stimulus
GO:0009566 fertilization
GO:0009615 response to virus
GO:0010288 response to lead ion
GO:0014070 response to organic cyclic compound
GO:0021987 cerebral cortex development
GO:0032465 regulation of cytokinesis
GO:0032496 response to lipopolysaccharide
GO:0032946 positive regulation of mononuclear cell proliferation
GO:0034097 response to cytokine
GO:0034976 response to endoplasmic reticulum stress
GO:0035234 ectopic germ cell programmed cell death
GO:0036017 response to erythropoietin
GO:0036018 cellular response to erythropoietin
GO:0036466 synaptic vesicle recycling via endosome
GO:0040008 regulation of growth
GO:0042542 response to hydrogen peroxide
GO:0042981 regulation of apoptotic process
GO:0043065 positive regulation of apoptotic process
GO:0043066 negative regulation of apoptotic process
GO:0043434 response to peptide hormone
GO:0043524 negative regulation of neuron apoptotic process
GO:0044565 dendritic cell proliferation
GO:0046898 response to cycloheximide
GO:0046902 regulation of mitochondrial membrane permeability
GO:0050673 epithelial cell proliferation
GO:0051093 negative regulation of developmental process
GO:0051402 neuron apoptotic process
GO:0051602 response to electrical stimulus
GO:0051881 regulation of mitochondrial membrane potential
GO:0071230 cellular response to amino acid stimulus
GO:0071312 cellular response to alkaloid
GO:0071320 cellular response to cAMP
GO:0071347 cellular response to interleukin-1
GO:0071356 cellular response to tumor necrosis factor
GO:0071456 cellular response to hypoxia
GO:0071466 cellular response to xenobiotic stimulus
GO:0071480 cellular response to gamma radiation
GO:0071549 cellular response to dexamethasone stimulus
GO:0071732 cellular response to nitric oxide
GO:0071839 apoptotic process in bone marrow cell
GO:0097048 dendritic cell apoptotic process
GO:0097192 extrinsic apoptotic signaling pathway in absence of ligand
GO:0097284 hepatocyte apoptotic process
GO:1900118 negative regulation of execution phase of apoptosis
GO:1900242 regulation of synaptic vesicle endocytosis
GO:1900244 positive regulation of synaptic vesicle endocytosis
GO:1900452 regulation of long-term synaptic depression
GO:1902042 negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:1902230 negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
GO:1902236 negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
GO:1903077 negative regulation of protein localization to plasma membrane
GO:1905218 cellular response to astaxanthin
GO:1990646 cellular response to prolactin
GO:2000242 negative regulation of reproductive process
GO:2000302 positive regulation of synaptic vesicle exocytosis
GO:2000669 negative regulation of dendritic cell apoptotic process
GO:2000809 positive regulation of synaptic vesicle clustering
GO:2001171 positive regulation of ATP biosynthetic process
GO:2001243 negative regulation of intrinsic apoptotic signaling pathway
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005741 mitochondrial outer membrane
GO:0005743 mitochondrial inner membrane
GO:0005759 mitochondrial matrix
GO:0005783 endoplasmic reticulum
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005905 clathrin-coated pit
GO:0008021 synaptic vesicle
GO:0016020 membrane
GO:0030672 synaptic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0031965 nuclear membrane
GO:0031966 mitochondrial membrane
GO:0045202 synapse
GO:0097136 Bcl-2 family protein complex
GO:0098793 presynapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4qnq, PDBe:4qnq, PDBj:4qnq
PDBsum4qnq
PubMed
UniProtP53563|B2CL1_RAT Bcl-2-like protein 1 (Gene Name=Bcl2l1)

[Back to BioLiP]