Structure of PDB 4q3a Chain D

Receptor sequence

>4q3aD (length=259) Species: 269797 (Methanosarcina barkeri str. Fusaro)

MALLTPDDLININMQLQKADSAVQEVTGLDIKGICKALYGTFSSSEKVGI
VPVTSGNGIIGNFSASLHAITQYFGFDSFVTDMPDVSGYYEAVQNGAEII
LMADDRTFLAHNLKNGKMANNQPCTGIIYAEIASRYLKADSKDVLVVGLG
KVGFPGAEHLVQKDFRVYGYDADETLLERATSNLGIIPFDPANPKKFSII
FEATPCANTIPEAVLSENCVLSTPGIPCAISEELRDKYEVQLIAEPLGIG
TASMLYSVL

3D structure

• PDB: 4q3a The Formation of Pyrroline and Tetrahydropyridine Rings in Amino Acids Catalyzed by Pyrrolysine Synthase (PylD).
• Chain: D
• Resolution: 2.2 Å

Enzymatic activity

• Enzyme Commision number: 1.4.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAI	D	A2 N121 T125 G150 K151 V152 Y170 D171 A172 A203 T204 P205 T209 P224 P246 L247	A2 N121 T125 G150 K151 V152 Y170 D171 A172 A203 T204 P205 T209 P224 P246 L247
BS02	MG	D	Y129 E245 L247 I249	Y129 E245 L247 I249
BS03	2YC	D	L3 L4 V53 G58 I59 I60 F63 A103 N121	L3 L4 V53 G58 I59 I60 F63 A103 N121

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity

Biological Process

• GO:0008652 amino acid biosynthetic process

External links

• PDB: RCSB:4q3a, PDBe:4q3a, PDBj:4q3a
• PDBsum: 4q3a
• PubMed: 24916332
• UniProt: Q46E80|PYLD_METBF Pyrrolysine synthase (Gene Name=pylD)