Structure of PDB 4pj0 Chain D

Receptor sequence

>4pj0D (length=340) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]

GWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHG
LASSYLEGCNFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWT
FIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPL
GQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCA
IHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANRFWSQIFGIAFS
NKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFE
TFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL

3D structure

PDB

4pj0 Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.

Chain

Resolution

2.437 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.10.3.9: photosystem II.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FE	D	H214 H268	H202 H256
BS02	CLA	D	F157 I178 L182	F145 I166 L170
BS03	BCT	D	H214 Y244 H268	H202 Y232 H256
BS04	CLA	D	F120 I123 M126	F108 I111 M114
BS05	PHO	D	A208 L209 I213 W253 F257	A196 L197 I201 W241 F245
BS06	PHO	D	A41 W48 G121 L122 F125 Q129 N142 F146 P149 F153 F173 G174 V175 P275 L279	A29 W36 G109 L110 F113 Q117 N130 F134 P137 F141 F161 G162 V163 P263 L267
BS07	CLA	D	M198 V201 A202	M186 V189 A190
BS08	CLA	D	P149 V152 V156 F181 L182 F185 Q186 W191 T192 H197 G200 V201 V204 L205 S282 A283 V286	P137 V140 V144 F169 L170 F173 Q174 W179 T180 H185 G188 V189 V192 L193 S270 A271 V274
BS09	CLA	D	C40 L43 L90 L91 L92 W93 T112 F113 H117	C28 L31 L78 L79 L80 W81 T100 F101 H105

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0010242	oxygen evolving activity
GO:0016168	chlorophyll binding
GO:0016491	oxidoreductase activity
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0009523	photosystem II
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4pj0, PDBe:4pj0, PDBj:4pj0
PDBsum	4pj0
PubMed	25438669
UniProt	Q8CM25\|PSBD_THEVB Photosystem II D2 protein (Gene Name=psbD1)

[Back to BioLiP]