Structure of PDB 4oxs Chain D |
>4oxsD (length=91) Species: 156889 (Magnetococcus marinus MC-1) [Search protein sequence] |
GVGSVAALLTVVFYIAAVMATNLYGATFPEWFGDLSKSLYTLFQVMTLES WSMGIVRPVMNVHPNAWVFFIPFIMLTTFTVLNLFIGIIVD |
|
PDB | 4oxs Prokaryotic NavMs channel as a structural and functional model for eukaryotic sodium channel antagonism. |
Chain | D |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
2CV |
D |
S165 K166 |
S36 K37 |
|
|
|
|