Structure of PDB 4ooa Chain D

Receptor sequence
>4ooaD (length=64) Species: 9606 (Homo sapiens) [Search protein sequence]
SLINLKIQKENPKVVNEINIEDLSLTKAAYCRCWRSKTFPACDGSCNKHN
ELTGDNVGPLILKK
3D structure
PDB4ooa A point mutation in the [2Fe-2S] cluster binding region of the NAF-1 protein (H114C) dramatically hinders the cluster donor properties.
ChainD
Resolution1.58 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FES D C99 R100 C101 C110 D111 G112 S113 C114 P127 C31 R32 C33 C42 D43 G44 S45 C46 P59
Gene Ontology
Molecular Function
GO:0051537 2 iron, 2 sulfur cluster binding
Biological Process
GO:0010506 regulation of autophagy
Cellular Component
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ooa, PDBe:4ooa, PDBj:4ooa
PDBsum4ooa
PubMed24914968
UniProtQ8N5K1|CISD2_HUMAN CDGSH iron-sulfur domain-containing protein 2 (Gene Name=CISD2)

[Back to BioLiP]