Structure of PDB 4onx Chain D |
>4onxD (length=126) Species: 195103 (Clostridium perfringens ATCC 13124) [Search protein sequence] |
YMDEDVRNTLKETAFSISEIPFIQEDLSNGEINSRIQEYTKHFIEAINDV DIIVVADMRGVKYSHLDEKQIGQVFVNEDKKEVLTQGSSYYSLMKGSMGE TLRWFQPVMYNGKQVGFIMVGKYYNE |
|
PDB | 4onx 2.8 Angstrom Crystal Structure of Sensor Domain of Histidine Kinase from Clostridium perfringens. |
Chain | D |
Resolution | 2.8 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
K45 |
Catalytic site (residue number reindexed from 1) |
K11 |
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
D |
E72 H76 |
E38 H42 |
|
|
|