Structure of PDB 4ogr Chain D

Receptor sequence

>4ogrD (length=49) Species: 11707 (Human immunodeficiency virus type 1 (HXB3 ISOLATE))

MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGR

3D structure

• PDB: 4ogr AFF4 binding to Tat-P-TEFb indirectly stimulates TAR recognition of super elongation complexes at the HIV promoter.
• Chain: D
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	D	C22 H33 C34 C37	C22 H33 C34 C37

Gene Ontology

Molecular Function

• GO:0001070 RNA-binding transcription regulator activity

Biological Process

• GO:0050434 positive regulation of viral transcription

Cellular Component

• GO:0042025 host cell nucleus

External links

• PDB: RCSB:4ogr, PDBe:4ogr, PDBj:4ogr
• PDBsum: 4ogr
• PubMed: 24843025
• UniProt: P69698|TAT_HV1H3 Protein Tat (Gene Name=tat)