Structure of PDB 4ogq Chain D

Receptor sequence

>4ogqD (length=166) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418)

DVPDMGRRQFMNLLTFGTVTGVALGALYPVVNYFIPPAAGGAGGGTTAKD
ELGNDVSVSKFLESHNVGDRTLVQGLKGDPTYIVAITDYGINAVCTHLGC
VVPWNAAENKFKCPCHGSQYDATGKVVRGPAPKSLALSHAKTENDKIVLT
SWTETDFRTGEEPWWS

3D structure

• PDB: 4ogq Internal Lipid Architecture of the Hetero-Oligomeric Cytochrome b6f Complex.
• Chain: D
• Resolution: 2.501 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H129
• Catalytic site (residue number reindexed from 1): H116
• Enzyme Commision number: 7.1.1.6: plastoquinol--plastocyanin reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	D	C108 H110 L111 C113 C126 C128 H129 S131	C95 H97 L98 C100 C113 C115 H116 S118
BS02	2WD	D	Y36 V39 I43	Y28 V31 I35

Gene Ontology

Molecular Function

• GO:0009496 plastoquinol--plastocyanin reductase activity
• GO:0016491 oxidoreductase activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
• GO:0046872 metal ion binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0015979 photosynthesis
• GO:0055085 transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:4ogq, PDBe:4ogq, PDBj:4ogq
• PDBsum: 4ogq
• PubMed: 24931468
• UniProt: Q93SX0|UCRIA_NOSS1 Cytochrome b6-f complex iron-sulfur subunit 1 (Gene Name=petC1)