Structure of PDB 4nyv Chain D |
>4nyvD (length=114) Species: 9606 (Homo sapiens) [Search protein sequence] |
KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNP MDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLA EVFEQEIDPVMQSL |
|
PDB | 4nyv Crystal Structure of the Bromodomain of human CREBBP in complex with a quinazolin-one ligand |
Chain | D |
Resolution | 1.83 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
15E |
D |
P1110 N1168 V1174 |
P28 N86 V92 |
|
|
|
|