Structure of PDB 4no4 Chain D

Receptor sequence

>4no4D (length=134) Species: 10116 (Rattus norvegicus) [Search protein sequence]

ACGLVASNLNAKPGECLKVRGELAPDAKSFVLNLGKDSNNLCLHFNPRFN
AHGDANTIVCNSKDDGTWGTEQRETAFPFQPGSITEVCITFDQADLTIKL
PDGHEFKFPNRLNMEAINYMAADGDFKIKCVAFE

3D structure

PDB

4no4 Crystal Structure of Galectin-1 L11A mutant

Chain

Resolution

1.399 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BGC	D	R49 E72	R48 E71
BS02	GAL	D	H45 R49 N62 W69 E72	H44 R48 N61 W68 E71

Gene Ontology

	Biological Process
GO:0002317	plasma cell differentiation
GO:0006915	apoptotic process
GO:0009410	response to xenobiotic stimulus
GO:0010812	negative regulation of cell-substrate adhesion
GO:0010977	negative regulation of neuron projection development
GO:0031295	T cell costimulation
GO:0034120	positive regulation of erythrocyte aggregation
GO:0035900	response to isolation stress
GO:0043065	positive regulation of apoptotic process
GO:0045185	maintenance of protein location
GO:0045445	myoblast differentiation
GO:0046598	positive regulation of viral entry into host cell
GO:0048678	response to axon injury
GO:0050729	positive regulation of inflammatory response
GO:0071333	cellular response to glucose stimulus
GO:0071407	cellular response to organic cyclic compound
GO:0098609	cell-cell adhesion
GO:2001200	positive regulation of dendritic cell differentiation

External links

PDB	RCSB:4no4, PDBe:4no4, PDBj:4no4
PDBsum	4no4
PubMed
UniProt	P11762\|LEG1_RAT Galectin-1 (Gene Name=Lgals1)