Structure of PDB 4mte Chain D

Receptor sequence
>4mteD (length=151) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
EKTTTQELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLL
REAEPQAKPPTVYRALDFLLEQGFVHKVESTNSYVLCHLFDQPTHTSAMF
ICDRCGAVKEECAEGVEDIMHTLAAKMGFALRHNVIEAHGLCAACVEVEA
C
3D structure
PDB4mte Structural and Mechanistic Basis of Zinc Regulation Across the E. coli Zur Regulon.
ChainD
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D T25 Q27 R28 Q57 P61 R65 T24 Q26 R27 Q56 P60 R64
BS02 dna D Y45 P61 Y64 Y85 Y44 P60 Y63 Y84
BS03 ZN D C103 C106 C146 C102 C105 C145
BS04 ZN D H77 C88 H96 E111 H76 C87 H95 E110
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0042802 identical protein binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:1900376 regulation of secondary metabolite biosynthetic process
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4mte, PDBe:4mte, PDBj:4mte
PDBsum4mte
PubMed25369000
UniProtP0AC51|ZUR_ECOLI Zinc uptake regulation protein (Gene Name=zur)

[Back to BioLiP]