Structure of PDB 4mqj Chain D

Receptor sequence
>4mqjD (length=145) Species: 9606 (Homo sapiens) [Search protein sequence]
HFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSA
SAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPE
NFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH
3D structure
PDB4mqj Structure of Wild-type Fetal Human Hemoglobin HbF
ChainD
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM D T38 F41 F42 H63 V67 S70 L88 H92 L96 V98 N102 F103 L106 L141 T37 F40 F41 H62 V66 S69 L87 H91 L95 V97 N101 F102 L105 L140
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0005515 protein binding
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0031721 hemoglobin alpha binding
GO:0043177 organic acid binding
GO:0046872 metal ion binding
Biological Process
GO:0015670 carbon dioxide transport
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005829 cytosol
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex
GO:0072562 blood microparticle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4mqj, PDBe:4mqj, PDBj:4mqj
PDBsum4mqj
PubMed
UniProtP69892|HBG2_HUMAN Hemoglobin subunit gamma-2 (Gene Name=HBG2)

[Back to BioLiP]