Structure of PDB 4md7 Chain D

Receptor sequence
>4md7D (length=195) Species: 9606 (Homo sapiens) [Search protein sequence]
VSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDL
EPDPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRV
YCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTG
FPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNF
3D structure
PDB4md7 Active Form of the Protein Kinase CK2 alpha 2 beta 2 Holoenzyme Is a Strong Complex with Symmetric Architecture.
ChainD
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ZN D C109 C114 C137 C140 C97 C102 C125 C128
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0004674 protein serine/threonine kinase activity
GO:0005102 signaling receptor binding
GO:0005515 protein binding
GO:0019887 protein kinase regulator activity
GO:0019904 protein domain specific binding
GO:0030674 protein-macromolecule adaptor activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
Biological Process
GO:0007165 signal transduction
GO:0008285 negative regulation of cell population proliferation
GO:0016055 Wnt signaling pathway
GO:0018107 peptidyl-threonine phosphorylation
GO:0032435 negative regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032927 positive regulation of activin receptor signaling pathway
GO:0033211 adiponectin-activated signaling pathway
GO:0043537 negative regulation of blood vessel endothelial cell migration
GO:0051101 regulation of DNA binding
GO:0060391 positive regulation of SMAD protein signal transduction
GO:0061154 endothelial tube morphogenesis
GO:0065003 protein-containing complex assembly
GO:0075342 symbiont-mediated disruption of host cell PML body
GO:1903901 negative regulation of viral life cycle
Cellular Component
GO:0000785 chromatin
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005956 protein kinase CK2 complex
GO:0016605 PML body
GO:0031519 PcG protein complex
GO:0034774 secretory granule lumen
GO:0070062 extracellular exosome
GO:1904813 ficolin-1-rich granule lumen

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4md7, PDBe:4md7, PDBj:4md7
PDBsum4md7
PubMed24175891
UniProtP67870|CSK2B_HUMAN Casein kinase II subunit beta (Gene Name=CSNK2B)

[Back to BioLiP]