Structure of PDB 4ku0 Chain D |
>4ku0D (length=96) Species: 10665 (Tequatrovirus T4) [Search protein sequence] |
SGLSYDKCVTAGHEAWPPTVVNATQSKVFTGGIAVLVAGDPITEHTEIKK PYETHGGVTQPRTSKVYVTGKKAVQMADPISCGDTVAQASSKVFIK |
|
PDB | 4ku0 Crystall structute of the business end of the T4 cell-puncturing device |
Chain | D |
Resolution | 1.15 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
D |
H14 H46 H56 C83 |
H13 H45 H55 C82 |
|
|
|
|