Structure of PDB 4kis Chain D

Receptor sequence

>4kisD (length=287) Species: 272626 (Listeria innocua Clip11262) [Search protein sequence]

RDRMVMGKIKRIEAGLPLTTAKGRTFGYDVIDTKLYINEEEAKQLRLIYD
IFEEEQSITFLQKRLKKLGFKVRTYNRYNNWLTNDLYCGYVSYKDKVHVK
GIHEPIISEEQFYRVQEIFSRMGKNPNMNKESASLLNNLVVCSKCGLGFV
HRRKDTVSRGKKYHYRYYSCKTYKHTHELEKCGNKIWRADKLEELIIDRV
NNYSFASRNIDKELNEKLKIEIDAQINYYEAQIEANEELKKNKKIQEFNS
LEFREKQLYLKSLINKIYIDGEQVTIEWLLEHHHHHH

3D structure

PDB

4kis Attachment site recognition and regulation of directionality by the serine integrases.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	D	R135 M136 K140 R143 T152 A153 K154 T165 S189 T191 Y207 M254 K262 K286 T288 S290 R291 K293 Y295 Y297 Y299 K313 R320	R3 M4 K8 R11 T20 A21 K22 T33 S57 T59 Y75 M122 K130 K154 T156 S158 R159 K161 Y163 Y165 Y167 K181 R188	PDBbind-CN: Kd~20nM
BS02	dna	D	R133 M136 L150 R156 R209 N212 Y225 K226 N259 S264 S266 N269 V282 H283 R285 T288 K303 K306	R1 M4 L18 R24 R77 N80 Y93 K94 N127 S132 S134 N137 V150 H151 R153 T156 K171 K174	PDBbind-CN: Kd~20nM
BS03	ZN	D	H455 H459	H282 H286
BS04	ZN	D	C274 C302	C142 C170

Gene Ontology

	Molecular Function
GO:0000150	DNA strand exchange activity
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:4kis, PDBe:4kis, PDBj:4kis
PDBsum	4kis
PubMed	23821671
UniProt	Q928V6

[Back to BioLiP]