Structure of PDB 4kh1 Chain D

Receptor sequence

>4kh1D (length=147) Species: 595495 (Escherichia coli KO11FL)

LQVEAIKRGTVIDHIPAQIGFKLLSLFKLTETDQRITIGLNLPSGEMGRK
DLIKIENTFLSEDQVDQLALYAPQATVNRIDNYEVVGKSRPSLPERIDNV
LVCPNSNCISHAEPVSSSFAVRKRANDIALKCKYCEKEFSHNVVLAN

3D structure

• PDB: 4kh1 New Paradigm for Allosteric Regulation of Escherichia coli Aspartate Transcarbamoylase.
• Chain: D
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	D	C109 C114 C138 C141	C103 C108 C132 C135
BS02	CTP	D	A11 I12 H20 K60 N84 I86 Y89 K94	A5 I6 H14 K54 N78 I80 Y83 K88
BS03	UTP	D	L7 Q8 V9 H20 P49 S50 G51 E52 K56 L58 K60	L1 Q2 V3 H14 P43 S44 G45 E46 K50 L52 K54

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Nov 26 07:05:47 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4kh1', asym_id = 'D', title = 'New Paradigm for Allosteric Regulation of Escherichia coli Aspartate Transcarbamoylase.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4kh1', asym_id='D', title='New Paradigm for Allosteric Regulation of Escherichia coli Aspartate Transcarbamoylase.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0006207,0009347', uniprot = '', pdbid = '4kh1', asym_id = 'D'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006207,0009347', uniprot='', pdbid='4kh1', asym_id='D')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>