Structure of PDB 4kh0 Chain D

Receptor sequence
>4kh0D (length=152) Species: 595495 (Escherichia coli KO11FL) [Search protein sequence]
THDNKLQVEAIKRGTVIDHIPAQIGFKLLSLFKLTETDQRITIGLNLPSG
EMGRKDLIKIENTFLSEDQVDQLALYAPQATVNRIDNYEVVGKSRPSLPE
RIDNVLVCPNSNCISHAEPVSSSFAVRKRANDIALKCKYCEKEFSHNVVL
AN
3D structure
PDB4kh0 New Paradigm for Allosteric Regulation of Escherichia coli Aspartate Transcarbamoylase.
ChainD
Resolution2.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ZN D C109 C114 C138 C141 C108 C113 C137 C140
BS02 ATP D A11 I12 V17 H20 K60 I86 V91 K94 A10 I11 V16 H19 K59 I85 V90 K93
BS03 ATP D H20 L48 P49 S50 G51 E52 K56 K60 H19 L47 P48 S49 G50 E51 K55 K59
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Thu Dec 19 04:33:30 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4kh0', asym_id = 'D', title = 'New Paradigm for Allosteric Regulation of Escherichia coli Aspartate Transcarbamoylase.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4kh0', asym_id='D', title='New Paradigm for Allosteric Regulation of Escherichia coli Aspartate Transcarbamoylase.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0006207,0009347', uniprot = '', pdbid = '4kh0', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006207,0009347', uniprot='', pdbid='4kh0', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>